Lineage for d3rtua_ (3rtu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964456Domain d3rtua_: 3rtu A: [306480]
    automated match to d1os9a_
    complexed with ca, klj, zn

Details for d3rtua_

PDB Entry: 3rtu (more details), 2 Å

PDB Description: Human MMP12 catalytic domain in complex with*N*-Hydroxy-2-(2-(4-methoxyphenyl)ethylsulfonamido)acetamide
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3rtua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtua_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3rtua_:

Click to download the PDB-style file with coordinates for d3rtua_.
(The format of our PDB-style files is described here.)

Timeline for d3rtua_: