Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [311338] (1 PDB entry) |
Domain d3rq0a_: 3rq0 A: [306479] automated match to d2hyka_ complexed with 211, ca, gol, peg, pg4, po4 |
PDB Entry: 3rq0 (more details), 2.02 Å
SCOPe Domain Sequences for d3rq0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rq0a_ b.29.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} syvfadefdgpagsapsaakwtiakaretiqdptyweqpgrigqyrndrrnvfldgksnl viraakdgdtyysaklasvweggaghtwearikfncltagawpafwlgntgegeldiiew ygngswpsattvhaksnggewkthniavdngwhrwrtqwdaegarfwldytdgaqpyfev aasslpdwpfdqpgytmfvvlnlavagsgggdpsggtypadmlvdwvrvw
Timeline for d3rq0a_: