Lineage for d3rq0a_ (3rq0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781204Species Mycobacterium smegmatis [TaxId:246196] [311338] (1 PDB entry)
  8. 2781205Domain d3rq0a_: 3rq0 A: [306479]
    automated match to d2hyka_
    complexed with 211, ca, gol, peg, pg4, po4

Details for d3rq0a_

PDB Entry: 3rq0 (more details), 2.02 Å

PDB Description: The crystal structure of a glycosyl hydrolases (GH) family protein 16 from Mycobacterium smegmatis str. MC2 155
PDB Compounds: (A:) Glycosyl hydrolases family protein 16

SCOPe Domain Sequences for d3rq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rq0a_ b.29.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
syvfadefdgpagsapsaakwtiakaretiqdptyweqpgrigqyrndrrnvfldgksnl
viraakdgdtyysaklasvweggaghtwearikfncltagawpafwlgntgegeldiiew
ygngswpsattvhaksnggewkthniavdngwhrwrtqwdaegarfwldytdgaqpyfev
aasslpdwpfdqpgytmfvvlnlavagsgggdpsggtypadmlvdwvrvw

SCOPe Domain Coordinates for d3rq0a_:

Click to download the PDB-style file with coordinates for d3rq0a_.
(The format of our PDB-style files is described here.)

Timeline for d3rq0a_: