Lineage for d3rp0a_ (3rp0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2221040Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)
  8. 2221550Domain d3rp0a_: 3rp0 A: [306475]
    automated match to d3h30a_
    complexed with anp, mg, so4

Details for d3rp0a_

PDB Entry: 3rp0 (more details), 3 Å

PDB Description: Structure of human CK2alpha in complex with a non-hydrolysable ATP-analogue and magnesium ions
PDB Compounds: (A:) Casein kinase II subunit alpha, Casein kinase II subunit alpha'

SCOPe Domain Sequences for d3rp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rp0a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfypvvke

SCOPe Domain Coordinates for d3rp0a_:

Click to download the PDB-style file with coordinates for d3rp0a_.
(The format of our PDB-style files is described here.)

Timeline for d3rp0a_: