![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
![]() | Family b.3.5.0: automated matches [310675] (1 protein) not a true family |
![]() | Protein automated matches [310876] (1 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [311335] (1 PDB entry) |
![]() | Domain d3rkpb3: 3rkp B:409-514 [306469] Other proteins in same PDB: d3rkpa2, d3rkpb2 automated match to d3kpta2 |
PDB Entry: 3rkp (more details), 2.24 Å
SCOPe Domain Sequences for d3rkpb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkpb3 b.3.5.0 (B:409-514) automated matches {Bacillus cereus [TaxId: 226900]} ttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipygdy qifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennk
Timeline for d3rkpb3: