![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [311336] (1 PDB entry) |
![]() | Domain d3rkpb2: 3rkp B:268-408 [306468] Other proteins in same PDB: d3rkpa1, d3rkpa3, d3rkpb1, d3rkpb3 automated match to d3kpta3 |
PDB Entry: 3rkp (more details), 2.24 Å
SCOPe Domain Sequences for d3rkpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkpb2 b.2.3.0 (B:268-408) automated matches {Bacillus cereus [TaxId: 226900]} eptidkkingklealpinpltnynydiktlipedikeykkyvvtatldnrlviqgkpivk idgaevnanvvevaiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntaki hftnkndvigekeskpvvvip
Timeline for d3rkpb2: