Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) |
Family b.3.5.0: automated matches [310675] (1 protein) not a true family |
Protein automated matches [310876] (1 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [311335] (1 PDB entry) |
Domain d3rkpb1: 3rkp B:166-267 [306467] Other proteins in same PDB: d3rkpa2, d3rkpb2 automated match to d3kpta1 |
PDB Entry: 3rkp (more details), 2.24 Å
SCOPe Domain Sequences for d3rkpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkpb1 b.3.5.0 (B:166-267) automated matches {Bacillus cereus [TaxId: 226900]} krgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyyfqetk apkgyvidptkreffvknsgtinedgtitsgtvvkmevknne
Timeline for d3rkpb1: