Lineage for d3rkpa3 (3rkp A:409-515)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042542Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2042605Family b.3.5.0: automated matches [310675] (1 protein)
    not a true family
  6. 2042606Protein automated matches [310876] (1 species)
    not a true protein
  7. 2042607Species Bacillus cereus [TaxId:226900] [311335] (1 PDB entry)
  8. 2042609Domain d3rkpa3: 3rkp A:409-515 [306466]
    Other proteins in same PDB: d3rkpa2, d3rkpb2
    automated match to d3kpta2

Details for d3rkpa3

PDB Entry: 3rkp (more details), 2.24 Å

PDB Description: Crystal structure of BcpA*(D312A), the major pilin subunit of Bacillus cereus
PDB Compounds: (A:) Collagen adhesion protein

SCOPe Domain Sequences for d3rkpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkpa3 b.3.5.0 (A:409-515) automated matches {Bacillus cereus [TaxId: 226900]}
ttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipygdy
qifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks

SCOPe Domain Coordinates for d3rkpa3:

Click to download the PDB-style file with coordinates for d3rkpa3.
(The format of our PDB-style files is described here.)

Timeline for d3rkpa3: