Lineage for d3rkpa2 (3rkp A:268-408)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377642Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2377643Protein automated matches [190503] (10 species)
    not a true protein
  7. 2377644Species Bacillus cereus [TaxId:226900] [311336] (1 PDB entry)
  8. 2377645Domain d3rkpa2: 3rkp A:268-408 [306465]
    Other proteins in same PDB: d3rkpa1, d3rkpa3, d3rkpb1, d3rkpb3
    automated match to d3kpta3

Details for d3rkpa2

PDB Entry: 3rkp (more details), 2.24 Å

PDB Description: Crystal structure of BcpA*(D312A), the major pilin subunit of Bacillus cereus
PDB Compounds: (A:) Collagen adhesion protein

SCOPe Domain Sequences for d3rkpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkpa2 b.2.3.0 (A:268-408) automated matches {Bacillus cereus [TaxId: 226900]}
eptidkkingklealpinpltnynydiktlipedikeykkyvvtatldnrlviqgkpivk
idgaevnanvvevaiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntaki
hftnkndvigekeskpvvvip

SCOPe Domain Coordinates for d3rkpa2:

Click to download the PDB-style file with coordinates for d3rkpa2.
(The format of our PDB-style files is described here.)

Timeline for d3rkpa2: