![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
![]() | Protein automated matches [191110] (11 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226570] (2 PDB entries) |
![]() | Domain d3rfob1: 3rfo B:1-204 [306451] Other proteins in same PDB: d3rfoa2, d3rfoa3, d3rfob2, d3rfob3, d3rfoc2, d3rfoc3, d3rfod2, d3rfod3 automated match to d4iqfa1 complexed with gol, pge, so4 |
PDB Entry: 3rfo (more details), 2.4 Å
SCOPe Domain Sequences for d3rfob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rfob1 c.65.1.0 (B:1-204) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhgipv lqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrggap ihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahllskt vplliqgklepikqneeevtfayn
Timeline for d3rfob1: