Lineage for d3re2a2 (3re2 A:206-475)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007372Protein Menin C-terminal domain [310725] (2 species)
  7. 2007393Species Nematostella vectensis [TaxId:45351] [310973] (1 PDB entry)
  8. 2007394Domain d3re2a2: 3re2 A:206-475 [306446]
    Other proteins in same PDB: d3re2a1
    complexed with gol

Details for d3re2a2

PDB Entry: 3re2 (more details), 1.95 Å

PDB Description: Crystal structure of menin reveals the binding site for Mixed Lineage Leukemia (MLL) protein
PDB Compounds: (A:) Predicted protein

SCOPe Domain Sequences for d3re2a2:

Sequence, based on SEQRES records: (download)

>d3re2a2 a.118.8.1 (A:206-475) Menin C-terminal domain {Nematostella vectensis [TaxId: 45351]}
trhmevasiissinpninhttdsiqlsqlqqellwllydmghiktypmaianlgdleeis
ptpgrppaeelfkeaitvakreysdhhiypytylggyyyrkkkyyeaiaswvdagyvagk
ynyskddeemykefheiandlipnilkdavakadpsgtgstnltsdpkffalvlqfydgi
clweegsptpvlhadwakklvqsigkfapecrsafnantdtlslrsakmremknlittsg
klntsamklqlta

Sequence, based on observed residues (ATOM records): (download)

>d3re2a2 a.118.8.1 (A:206-475) Menin C-terminal domain {Nematostella vectensis [TaxId: 45351]}
trhmevasiissinpninhttdsiqlsqlqqellwllydmghiktypmaianlgdleeis
ptpgrppaeelfkeaitvakreysdhhiypytylggyyyrkkkyyeaiaswvdagyvagk
ynyskddeemykefheiandlipnilkdavakanltsdpkffalvlqfydgiclweegsp
tpvlhadwakklvqsigkfapecrsafnantdtlslrsakmremknlitntsamklqlta

SCOPe Domain Coordinates for d3re2a2:

Click to download the PDB-style file with coordinates for d3re2a2.
(The format of our PDB-style files is described here.)

Timeline for d3re2a2:

  • d3re2a2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3re2a1