SCOPe 2.07: Domain d3rcaj1: 3rca J:2-92

Lineage for d3rcaj1 (3rca J:2-92)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
Protein automated matches [231466] (5 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)

Domain d3rcaj1: 3rca J:2-92 [306436]
Other proteins in same PDB: d3rcaa2, d3rcab1, d3rcab2, d3rcac1, d3rcac2, d3rcaj2, d3rcak1, d3rcak2, d3rcal1, d3rcal2
automated match to d3ax7a1
complexed with fad, fes, mte, rmo

Details for d3rcaj1

PDB Entry: 3rca (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Form of Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3rcaj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rcaj1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3rcaj1:

Click to download the PDB-style file with coordinates for d3rcaj1.
(The format of our PDB-style files is described here.)

Timeline for d3rcaj1: