SCOPe 2.08: Domain d3rcac1: 3rca C:571-694

Lineage for d3rcac1 (3rca C:571-694)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)

8. Domain d3rcac1: 3rca C:571-694 [306434]
   Other proteins in same PDB: d3rcaa1, d3rcaa2, d3rcab1, d3rcab2, d3rcac2, d3rcaj1, d3rcaj2, d3rcak1, d3rcak2, d3rcal2
   automated match to d3b9jc1
   complexed with fad, fes, mte, rmo

Details for d3rcac1

PDB Entry: 3rca, 2.1 Å

PDB Description: Crystal Structure of Reduced Form of Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3rcac1:

Sequence; same for both SEQRES and ATOM records:

>d3rcac1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3rcac1:

• d3rcac1 first appeared in SCOPe 2.06
  
• d3rcac1 appears in SCOPe 2.07