Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries) |
Domain d3rcab2: 3rca B:415-528 [306433] Other proteins in same PDB: d3rcaa1, d3rcaa2, d3rcab1, d3rcac1, d3rcac2, d3rcaj1, d3rcaj2, d3rcak1, d3rcal1, d3rcal2 automated match to d1v97a4 complexed with fad, fes, mte, rmo |
PDB Entry: 3rca (more details), 2.1 Å
SCOPe Domain Sequences for d3rcab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rcab2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3rcab2: