| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
| Family d.67.3.0: automated matches [227278] (1 protein) not a true family |
| Protein automated matches [227087] (4 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [256271] (2 PDB entries) |
| Domain d3r8ny1: 3r8n Y:3-184 [306426] Other proteins in same PDB: d3r8ny2 automated match to d4gd1y_ |
PDB Entry: 3r8n (more details), 3 Å
SCOPe Domain Sequences for d3r8ny1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8ny1 d.67.3.0 (Y:3-184) automated matches {Escherichia coli K-12 [TaxId: 83333]}
isdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtved
srtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrgea
eqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkeae
lm
Timeline for d3r8ny1: