SCOPe 2.08: Domain d3r8ny1: 3r8n Y:3-184

Lineage for d3r8ny1 (3r8n Y:3-184)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.0: automated matches [227278] (1 protein)
   not a true family

6. Protein automated matches [227087] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256271] (2 PDB entries)

8. Domain d3r8ny1: 3r8n Y:3-184 [306426]
   Other proteins in same PDB: d3r8ny2
   automated match to d4gd1y_

Details for d3r8ny1

PDB Entry: 3r8n, 3 Å

PDB Description: Structures of the bacterial ribosome in classical and hybrid states of tRNA binding

PDB Compounds: (Y:) ribosome recycling factor

SCOPe Domain Sequences for d3r8ny1:

Sequence; same for both SEQRES and ATOM records:

>d3r8ny1 d.67.3.0 (Y:3-184) automated matches {Escherichia coli K-12 [TaxId: 83333]}
isdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtved
srtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrgea
eqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkeae
lm

Timeline for d3r8ny1:

• d3r8ny1 first appeared in SCOPe 2.06
  
• d3r8ny1 appears in SCOPe 2.07