Lineage for d3r78b_ (3r78 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984754Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries)
  8. 2984801Domain d3r78b_: 3r78 B: [306424]
    automated match to d4gkia_
    complexed with act, atp, ca, cl, na, pe3

Details for d3r78b_

PDB Entry: 3r78 (more details), 2.4 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, ATP-bound
PDB Compounds: (B:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d3r78b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r78b_ d.144.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
qretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsvand
vtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivdal
avflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhk
llpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslq
krlfqkygidnpdmnklqfhlmldeff

SCOPe Domain Coordinates for d3r78b_:

Click to download the PDB-style file with coordinates for d3r78b_.
(The format of our PDB-style files is described here.)

Timeline for d3r78b_: