Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries) |
Domain d3r78a_: 3r78 A: [306423] automated match to d4gkia_ complexed with act, atp, ca, cl, na, pe3 |
PDB Entry: 3r78 (more details), 2.4 Å
SCOPe Domain Sequences for d3r78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r78a_ d.144.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 509173]} shiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsv andvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgeniv dalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwke mhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefsp slqkrlfqkygidnpdmnklqfhlmldeff
Timeline for d3r78a_: