Lineage for d3r3la2 (3r3l A:364-561)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495279Species Lassa virus [TaxId:11620] [311334] (1 PDB entry)
  8. 2495280Domain d3r3la2: 3r3l A:364-561 [306409]
    Other proteins in same PDB: d3r3la1, d3r3lb1, d3r3lc1
    automated match to d3mwpa1
    complexed with mn, zn

Details for d3r3la2

PDB Entry: 3r3l (more details), 2.45 Å

PDB Description: structure of np protein from lassa av strain
PDB Compounds: (A:) nucleoprotein

SCOPe Domain Sequences for d3r3la2:

Sequence, based on SEQRES records: (download)

>d3r3la2 c.55.3.0 (A:364-561) automated matches {Lassa virus [TaxId: 11620]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdlkqf
kqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdiklid
ialskidsrkfenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg
glntlvlravlprdmvfr

Sequence, based on observed residues (ATOM records): (download)

>d3r3la2 c.55.3.0 (A:364-561) automated matches {Lassa virus [TaxId: 11620]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdlkqf
kqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdiklid
ialskidsrkfenavwdqykdlchmhtgvvvekkeeitphcalmdcimfdaavsgglntl
vlravlprdmvfr

SCOPe Domain Coordinates for d3r3la2:

Click to download the PDB-style file with coordinates for d3r3la2.
(The format of our PDB-style files is described here.)

Timeline for d3r3la2: