![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Lassa virus [TaxId:11620] [311334] (1 PDB entry) |
![]() | Domain d3r3la2: 3r3l A:364-561 [306409] Other proteins in same PDB: d3r3la1, d3r3lb1, d3r3lc1 automated match to d3mwpa1 complexed with mn, zn |
PDB Entry: 3r3l (more details), 2.45 Å
SCOPe Domain Sequences for d3r3la2:
Sequence, based on SEQRES records: (download)
>d3r3la2 c.55.3.0 (A:364-561) automated matches {Lassa virus [TaxId: 11620]} gltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdlkqf kqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdiklid ialskidsrkfenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg glntlvlravlprdmvfr
>d3r3la2 c.55.3.0 (A:364-561) automated matches {Lassa virus [TaxId: 11620]} gltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdlkqf kqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdiklid ialskidsrkfenavwdqykdlchmhtgvvvekkeeitphcalmdcimfdaavsgglntl vlravlprdmvfr
Timeline for d3r3la2:
![]() Domains from other chains: (mouse over for more information) d3r3lb1, d3r3lb2, d3r3lc1, d3r3lc2 |