Lineage for d3r3la1 (3r3l A:8-338)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017049Fold a.300: Arenavirus nucleocapsid protein-like [310566] (1 superfamily)
  4. 2017050Superfamily a.300.1: Arenavirus nucleocapsid protein N-terminal domain-like [310594] (1 family) (S)
    N-terminal half of Pfam PF00843
  5. 2017051Family a.300.1.1: Arenavirus nucleocapsid protein N-terminal domain [310641] (2 protein domains)
  6. 2017063Protein automated matches [310875] (1 species)
    not a true protein
  7. 2017064Species Lassa virus [TaxId:11620] [311333] (1 PDB entry)
  8. 2017065Domain d3r3la1: 3r3l A:8-338 [306408]
    Other proteins in same PDB: d3r3la2, d3r3lb2, d3r3lc2
    automated match to d3mwpa2
    complexed with mn, zn

Details for d3r3la1

PDB Entry: 3r3l (more details), 2.45 Å

PDB Description: Structure of NP protein from Lassa AV strain
PDB Compounds: (A:) nucleoprotein

SCOPe Domain Sequences for d3r3la1:

Sequence, based on SEQRES records: (download)

>d3r3la1 a.300.1.1 (A:8-338) automated matches {Lassa virus [TaxId: 11620]}
ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrddsdlkrl
rdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterplssgvymg
nlssqqldqrrallnligmtngsqgsqagrdgvvrvwdvknaellnnqfgtmpsltlacl
tkqgqvdlndvvqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfs
lgaavkagacmldggnmletikvspqsmdgilksilkvkralgmfvsdtpgernpyenil
ykiclsgdgwpyiasrtsivgrawentvvdl

Sequence, based on observed residues (ATOM records): (download)

>d3r3la1 a.300.1.1 (A:8-338) automated matches {Lassa virus [TaxId: 11620]}
ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrddsdlkrl
rdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterplssgvymg
nlssqqldqrrallnligmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlndv
vqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagacm
ldggnmletikvspqsmdgilksilkvkralgmfvsdtpgernpyenilykiclsgdgwp
yiasrtsivgrawentvvdl

SCOPe Domain Coordinates for d3r3la1:

Click to download the PDB-style file with coordinates for d3r3la1.
(The format of our PDB-style files is described here.)

Timeline for d3r3la1:

  • d3r3la1 is new in SCOPe 2.06-stable