Lineage for d3r39a1 (3r39 A:4-233)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916109Species Salmonella enterica [TaxId:90371] [256251] (2 PDB entries)
  8. 2916110Domain d3r39a1: 3r39 A:4-233 [306405]
    Other proteins in same PDB: d3r39a2
    automated match to d4f3sa_
    complexed with dal, gly, po4

Details for d3r39a1

PDB Entry: 3r39 (more details), 2.14 Å

PDB Description: Crystal structure of periplasmic D-alanine ABC transporter from Salmonella enterica
PDB Compounds: (A:) Putative periplasmic binding protein

SCOPe Domain Sequences for d3r39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r39a1 c.94.1.0 (A:4-233) automated matches {Salmonella enterica [TaxId: 90371]}
sivegrtlnvavspasppmlfksadgklqgidlelfssycqsrhcklniteyawdgmlga
vasgqadvafsgisitdkrkkvidfsepyyinsfylvsmanhkitlnnlnelnkysigyp
rgmaysdlikndlepkgyyslskvklyptynetmadlkngnldlafieepvyftfknkkk
mpiesryvfknvdqlgiafkkgspvrddfnlwlkeqgpqkisgivdswmk

SCOPe Domain Coordinates for d3r39a1:

Click to download the PDB-style file with coordinates for d3r39a1.
(The format of our PDB-style files is described here.)

Timeline for d3r39a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r39a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3r39b_