| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Salmonella enterica [TaxId:90371] [256251] (2 PDB entries) |
| Domain d3r39a1: 3r39 A:4-233 [306405] Other proteins in same PDB: d3r39a2 automated match to d4f3sa_ complexed with dal, gly, po4 |
PDB Entry: 3r39 (more details), 2.14 Å
SCOPe Domain Sequences for d3r39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r39a1 c.94.1.0 (A:4-233) automated matches {Salmonella enterica [TaxId: 90371]}
sivegrtlnvavspasppmlfksadgklqgidlelfssycqsrhcklniteyawdgmlga
vasgqadvafsgisitdkrkkvidfsepyyinsfylvsmanhkitlnnlnelnkysigyp
rgmaysdlikndlepkgyyslskvklyptynetmadlkngnldlafieepvyftfknkkk
mpiesryvfknvdqlgiafkkgspvrddfnlwlkeqgpqkisgivdswmk
Timeline for d3r39a1: