Lineage for d3qz1b_ (3qz1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005564Species Cow (Bos taurus) [TaxId:9913] [311318] (2 PDB entries)
  8. 2005570Domain d3qz1b_: 3qz1 B: [306398]
    automated match to d4y8wa_
    complexed with 3qz, hem

Details for d3qz1b_

PDB Entry: 3qz1 (more details), 3 Å

PDB Description: crystal structure of bovine steroid of 21-hydroxylase (p450c21)
PDB Compounds: (B:) Steroid 21-hydroxylase

SCOPe Domain Sequences for d3qz1b_:

Sequence, based on SEQRES records: (download)

>d3qz1b_ a.104.1.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hlpplvpgflhllqpnlpihllsltqklgpvyrlrlglqevvvlnskrtieeamirkwvd
fagrpqipsyklvsqrcqdislgdysllwkahkkltrsalllgtrssmepwvdqltqefc
ermrvqagapvtiqkefslltcsiicyltfgnkedtlvhafhdcvqdlmktwdhwsiqil
dmvpflrffpnpglwrlkqaienrdhmvekqlrrhkesmvagqwrdmtdymlqgvgrqrv
eegpgqlleghvhmsvvdlfiggtettastlswavafllhhpeiqrrlqeeldrelgpga
scsrvtykdrarlpllnatiaevlrlrpvvplalphrttrpssifgydipegmvvipnlq
gahldetvweqphefrpdrflepganpsalafgcgarvclgeslarlelfvvlarllqaf
tllpppvgalpslqpdpycgvnlkvqpfqvrlqpr

Sequence, based on observed residues (ATOM records): (download)

>d3qz1b_ a.104.1.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hlpplvpgflhllqpnlpihllsltqklgpvyrlrlglqevvvlnskrtieeamirkwvd
fagrpqipsyklvsqrcqdislgdysllwkahkkltrsalllsmepwvdqltqefcermr
vqagapvtiqkefslltcsiicyltfgnkedtlvhafhdcvqdlmktwdhwsiqildmvp
flrffpnpglwrlkqaienrdhmvekqlrrhkesmvagqwrdmtdymlqgvqlleghvhm
svvdlfiggtettastlswavafllhhpeiqrrlqeeldrelgprvtykdrarlpllnat
iaevlrlrpvvplalphrttrpssifgydipegmvvipnlqgahldetvweqphefrpdr
flepganpsalafgcgarvclgeslarlelfvvlarllqaftllpppvgalpslqpdpyc
gvnlkvqpfqvrlqpr

SCOPe Domain Coordinates for d3qz1b_:

Click to download the PDB-style file with coordinates for d3qz1b_.
(The format of our PDB-style files is described here.)

Timeline for d3qz1b_:

  • d3qz1b_ is new in SCOPe 2.06-stable