Lineage for d3qlud_ (3qlu D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144186Species Norway rat (Rattus norvegicus) [TaxId:10116] [311293] (5 PDB entries)
  8. 2144192Domain d3qlud_: 3qlu D: [306388]
    automated match to d3sajd_
    complexed with cl, gol, nag

Details for d3qlud_

PDB Entry: 3qlu (more details), 2.91 Å

PDB Description: Crystal structure of the GluK2/GluK5 (GluR6/KA2) ATD dimer assembly
PDB Compounds: (D:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3qlud_:

Sequence, based on SEQRES records: (download)

>d3qlud_ c.93.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
thvlrfggifeyvesgpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfeas
kkacdqlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypd
fsslsraildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkdak
pllkemkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrys
gvnmtgfrilntentqvssiiekwsmerlqappkpdsglldgfmttdaalmydavhvvsv
avqqfpqmtvsslqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvi
slkeeglekigtwdpasglnmt

Sequence, based on observed residues (ATOM records): (download)

>d3qlud_ c.93.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
thvlrfggifeyvesgpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfeas
kkacdqlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypd
fsslsraildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkdak
pllkemkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrys
gvnmtgfrilntentqvssiiekwsmesglldgfmttdaalmydavhvvsvavqqfpqmt
vsslqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvislkeeglek
igtwdpasglnmt

SCOPe Domain Coordinates for d3qlud_:

Click to download the PDB-style file with coordinates for d3qlud_.
(The format of our PDB-style files is described here.)

Timeline for d3qlud_:

  • d3qlud_ is new in SCOPe 2.06-stable