Lineage for d3qltb_ (3qlt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144186Species Norway rat (Rattus norvegicus) [TaxId:10116] [311293] (5 PDB entries)
  8. 2144196Domain d3qltb_: 3qlt B: [306386]
    automated match to d3sajd_
    complexed with nag

Details for d3qltb_

PDB Entry: 3qlt (more details), 2.99 Å

PDB Description: Crystal structure of a GluK2 (GluR6) glycan wedge homodimer assembly
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3qltb_:

Sequence, based on SEQRES records: (download)

>d3qltb_ c.93.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vlrfggifeyvesgpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfeaskk
acdqlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypdfs
slsraildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkdakpl
lkemkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrysgv
nmtgfrilntentqvssiiekwsmerlqappkpdsglldgfmttdaalmydavhvvsvav
qqfpqmtvsslqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvisl
keeglekigtwdpasglnmte

Sequence, based on observed residues (ATOM records): (download)

>d3qltb_ c.93.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vlrfggifemgaeelafrfavntinrnrtllpttltydtqkinlydsfeaskkacdqlsl
gvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypdfsslsrail
dlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpdtkdakpllkemkrgk
efhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrysgvnmtgfril
ntentqvssiiekwsmerpdsglldgfmttdaalmydavhvvsvavqqfpqmtvsslqcn
rhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvislkeeglekigtwdpa
sglnmte

SCOPe Domain Coordinates for d3qltb_:

Click to download the PDB-style file with coordinates for d3qltb_.
(The format of our PDB-style files is described here.)

Timeline for d3qltb_:

  • d3qltb_ is new in SCOPe 2.06-stable