Lineage for d1ddog1 (1ddo G:1-194,G:288-339)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67446Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 67447Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 67476Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 67477Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 67478Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 67507Domain d1ddog1: 1ddo G:1-194,G:288-339 [30637]
    Other proteins in same PDB: d1ddoa2, d1ddob2, d1ddoc2, d1ddod2, d1ddoe2, d1ddof2, d1ddog2, d1ddoh2

Details for d1ddog1

PDB Entry: 1ddo (more details), 3.1 Å

PDB Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp

SCOP Domain Sequences for d1ddog1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddog1 c.4.1.2 (G:1-194,G:288-339) D-amino acid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOP Domain Coordinates for d1ddog1:

Click to download the PDB-style file with coordinates for d1ddog1.
(The format of our PDB-style files is described here.)

Timeline for d1ddog1: