SCOPe 2.07: Domain d3qajk1: 3qaj K:6-104

Lineage for d3qajk1 (3qaj K:6-104)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)

8. Domain d3qajk1: 3qaj K:6-104 [306353]
   Other proteins in same PDB: d3qaja2, d3qajb2, d3qajc2, d3qajd2, d3qaje2, d3qajf2, d3qajg2, d3qajh2, d3qaji2, d3qajj2, d3qajk2, d3qajl2
   automated match to d4lnia1
   complexed with adp, amp, cit, glu, mg, po4, rgp

Details for d3qajk1

PDB Entry: 3qaj, 3.05 Å

PDB Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP

PDB Compounds: (K:) glutamine synthetase

SCOPe Domain Sequences for d3qajk1:

Sequence; same for both SEQRES and ATOM records:

>d3qajk1 d.15.9.0 (K:6-104) automated matches {Bacillus subtilis [TaxId: 1423]}
redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
sdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d3qajk1:

• d3qajk1 first appeared in SCOPe 2.06
  
• d3qajk1 appears in the current release, SCOPe 2.08