Lineage for d3qajj1 (3qaj J:6-104)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541920Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2542045Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2542046Protein automated matches [226862] (5 species)
    not a true protein
  7. 2542047Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)
  8. 2542075Domain d3qajj1: 3qaj J:6-104 [306351]
    Other proteins in same PDB: d3qaja2, d3qajb2, d3qajc2, d3qajd2, d3qaje2, d3qajf2, d3qajg2, d3qajh2, d3qaji2, d3qajj2, d3qajk2, d3qajl2
    automated match to d4lnia1
    complexed with adp, amp, cit, glu, mg, po4, rgp

Details for d3qajj1

PDB Entry: 3qaj (more details), 3.05 Å

PDB Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP
PDB Compounds: (J:) glutamine synthetase

SCOPe Domain Sequences for d3qajj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qajj1 d.15.9.0 (J:6-104) automated matches {Bacillus subtilis [TaxId: 1423]}
redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
sdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d3qajj1:

Click to download the PDB-style file with coordinates for d3qajj1.
(The format of our PDB-style files is described here.)

Timeline for d3qajj1: