![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (6 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries) |
![]() | Domain d3qajd2: 3qaj D:105-444 [306340] Other proteins in same PDB: d3qaja1, d3qajb1, d3qajc1, d3qajd1, d3qaje1, d3qajf1, d3qajg1, d3qajh1, d3qaji1, d3qajj1, d3qajk1, d3qajl1 automated match to d4lnia2 complexed with adp, amp, cit, glu, mg, po4, rgp |
PDB Entry: 3qaj (more details), 3.05 Å
SCOPe Domain Sequences for d3qajd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qajd2 d.128.1.0 (D:105-444) automated matches {Bacillus subtilis [TaxId: 1423]} egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy
Timeline for d3qajd2: