Lineage for d3qajc2 (3qaj C:105-444)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581562Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2581563Protein automated matches [227028] (6 species)
    not a true protein
  7. 2581564Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2581585Domain d3qajc2: 3qaj C:105-444 [306338]
    Other proteins in same PDB: d3qaja1, d3qajb1, d3qajc1, d3qajd1, d3qaje1, d3qajf1, d3qajg1, d3qajh1, d3qaji1, d3qajj1, d3qajk1, d3qajl1
    automated match to d4lnia2
    complexed with adp, amp, cit, glu, mg, po4, rgp

Details for d3qajc2

PDB Entry: 3qaj (more details), 3.05 Å

PDB Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d3qajc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qajc2 d.128.1.0 (C:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d3qajc2:

Click to download the PDB-style file with coordinates for d3qajc2.
(The format of our PDB-style files is described here.)

Timeline for d3qajc2: