SCOPe 2.08: Domain d3qajc2: 3qaj C:105-444

Lineage for d3qajc2 (3qaj C:105-444)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)

8. Domain d3qajc2: 3qaj C:105-444 [306338]
   Other proteins in same PDB: d3qaja1, d3qajb1, d3qajc1, d3qajd1, d3qaje1, d3qajf1, d3qajg1, d3qajh1, d3qaji1, d3qajj1, d3qajk1, d3qajl1
   automated match to d4lnia2
   complexed with adp, amp, cit, glu, mg, po4, rgp

Details for d3qajc2

PDB Entry: 3qaj, 3.05 Å

PDB Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP

PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d3qajc2:

Sequence; same for both SEQRES and ATOM records:

>d3qajc2 d.128.1.0 (C:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

Timeline for d3qajc2:

• d3qajc2 first appeared in SCOPe 2.06
  
• d3qajc2 appears in SCOPe 2.07