Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries) |
Domain d3qajc1: 3qaj C:4-104 [306337] Other proteins in same PDB: d3qaja2, d3qajb2, d3qajc2, d3qajd2, d3qaje2, d3qajf2, d3qajg2, d3qajh2, d3qaji2, d3qajj2, d3qajk2, d3qajl2 automated match to d4lnia1 complexed with adp, amp, cit, glu, mg, po4, rgp |
PDB Entry: 3qaj (more details), 3.05 Å
SCOPe Domain Sequences for d3qajc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qajc1 d.15.9.0 (C:4-104) automated matches {Bacillus subtilis [TaxId: 1423]} ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d3qajc1: