Lineage for d3qajb2 (3qaj B:105-444)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214486Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2214487Protein automated matches [227028] (5 species)
    not a true protein
  7. 2214488Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2214508Domain d3qajb2: 3qaj B:105-444 [306336]
    Other proteins in same PDB: d3qaja1, d3qajb1, d3qajc1, d3qajd1, d3qaje1, d3qajf1, d3qajg1, d3qajh1, d3qaji1, d3qajj1, d3qajk1, d3qajl1
    automated match to d4lnia2
    complexed with adp, amp, cit, glu, mg, po4, rgp

Details for d3qajb2

PDB Entry: 3qaj (more details), 3.05 Å

PDB Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP
PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d3qajb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qajb2 d.128.1.0 (B:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d3qajb2:

Click to download the PDB-style file with coordinates for d3qajb2.
(The format of our PDB-style files is described here.)

Timeline for d3qajb2: