Lineage for d1ddoc1 (1ddo C:1-194,C:288-339)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1582697Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1582698Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 1582752Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
    This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold
  6. 1582753Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)
  7. 1582754Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 1582771Domain d1ddoc1: 1ddo C:1-194,C:288-339 [30633]
    Other proteins in same PDB: d1ddoa2, d1ddob2, d1ddoc2, d1ddod2, d1ddoe2, d1ddof2, d1ddog2, d1ddoh2
    complexed with dtr, fad, itr

Details for d1ddoc1

PDB Entry: 1ddo (more details), 3.1 Å

PDB Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp
PDB Compounds: (C:) d-amino acid oxidase

SCOPe Domain Sequences for d1ddoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddoc1 c.4.1.2 (C:1-194,C:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOPe Domain Coordinates for d1ddoc1:

Click to download the PDB-style file with coordinates for d1ddoc1.
(The format of our PDB-style files is described here.)

Timeline for d1ddoc1: