Lineage for d3q9el_ (3q9e L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000185Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 3000299Domain d3q9el_: 3q9e L: [306320]
    automated match to d4zuoa_
    complexed with k, na, sp5, zn

Details for d3q9el_

PDB Entry: 3q9e (more details), 2.5 Å

PDB Description: Crystal structure of H159A APAH complexed with acetylspermine
PDB Compounds: (L:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d3q9el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9el_ d.165.1.1 (L:) automated matches {Momordica balsamina [TaxId: 3672]}
mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl
kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai
spgtweaalssmasaidgadliaaghkaafslcrppghaagidmfggycfinnaavaaqr
lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag
agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd
yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag

SCOPe Domain Coordinates for d3q9el_:

Click to download the PDB-style file with coordinates for d3q9el_.
(The format of our PDB-style files is described here.)

Timeline for d3q9el_: