Lineage for d1evib1 (1evi B:1-194,B:288-340)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21132Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 21133Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 21160Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 21161Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 21162Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 21176Domain d1evib1: 1evi B:1-194,B:288-340 [30630]
    Other proteins in same PDB: d1evia2, d1evib2

Details for d1evib1

PDB Entry: 1evi (more details), 2.5 Å

PDB Description: three-dimensional structure of the purple intermediate of porcine kidney d-amino acid oxidase
PDB Compounds: (B:)

SCOP Domain Sequences for d1evib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evib1 c.4.1.2 (B:1-194,B:288-340) D-amino acid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernll

SCOP Domain Coordinates for d1evib1:

Click to download the PDB-style file with coordinates for d1evib1.
(The format of our PDB-style files is described here.)

Timeline for d1evib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evib2