Lineage for d3q7fa_ (3q7f A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007203Family a.118.6.0: automated matches [267630] (1 protein)
    not a true family
  6. 2007204Protein automated matches [267683] (4 species)
    not a true protein
  7. 2007210Species Cryptococcus neoformans [TaxId:235443] [311330] (5 PDB entries)
  8. 2007214Domain d3q7fa_: 3q7f A: [306284]
    automated match to d4l9pa_
    complexed with 3cx, ed2, fpp, so4, suc, zn

Details for d3q7fa_

PDB Entry: 3q7f (more details), 2.2 Å

PDB Description: Cryptococcus neoformans protein farnesyltransferase in complex with FPP and ethylenediamine inhibitor 1
PDB Compounds: (A:) Farnesyltransferase alpha subunit

SCOPe Domain Sequences for d3q7fa_:

Sequence, based on SEQRES records: (download)

>d3q7fa_ a.118.6.0 (A:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
tyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyfraiaakeekseralelte
iivrmnpahytvwqyrfslltslnksledelrlmnefavqnlksyqvwhhrlllldrisp
qdpvseieyihgsllpdpknyhtwaylhwlyshfstlgriseaqwgseldwcnemlrvdg
rnnsawgwrwylrvsrpgaetssrslqdeliyilksihliphnvsawnylrgflkhfslp
lvpilpailpytasklnpdietveafgfpmpsdplpedtplpvplaleyladsfieqnrv
ddaakvfeklsseydqmragywefrrreca

Sequence, based on observed residues (ATOM records): (download)

>d3q7fa_ a.118.6.0 (A:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
tyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyfraiaakeekseralelte
iivrmnpahytvwqyrfslltslnksledelrlmnefavqnlksyqvwhhrlllldrisp
qdpvseieyihgsllpdpknyhtwaylhwlyshfstlgriseaqwgseldwcnemlrvdg
rnnsawgwrwylrvsrpgaetssrslqdeliyilksihliphnvsawnylrgflkhfslp
lvpilpailpytafpmpspedtplpvplaleyladsfieqnrvddaakvfeklsseydqm
ragywefrrreca

SCOPe Domain Coordinates for d3q7fa_:

Click to download the PDB-style file with coordinates for d3q7fa_.
(The format of our PDB-style files is described here.)

Timeline for d3q7fa_:

  • d3q7fa_ is new in SCOPe 2.06-stable