Lineage for d1kifg1 (1kif G:1-194,G:288-339)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21132Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 21133Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 21160Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 21161Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 21162Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 21173Domain d1kifg1: 1kif G:1-194,G:288-339 [30627]
    Other proteins in same PDB: d1kifa2, d1kifb2, d1kifc2, d1kifd2, d1kife2, d1kiff2, d1kifg2, d1kifh2

Details for d1kifg1

PDB Entry: 1kif (more details), 2.6 Å

PDB Description: d-amino acid oxidase from pig kidney

SCOP Domain Sequences for d1kifg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kifg1 c.4.1.2 (G:1-194,G:288-339) D-amino acid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOP Domain Coordinates for d1kifg1:

Click to download the PDB-style file with coordinates for d1kifg1.
(The format of our PDB-style files is described here.)

Timeline for d1kifg1: