SCOPe 2.08: Domain d3pz7a1: 3pz7 A:386-468

Lineage for d3pz7a1 (3pz7 A:386-468)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d3pz7a1: 3pz7 A:386-468 [306266]
   Other proteins in same PDB: d3pz7a2
   automated match to d4wipc_
   complexed with edo

Details for d3pz7a1

PDB Entry: 3pz7, 2.44 Å

PDB Description: Crystal structure of Ccd1-DIX domain

PDB Compounds: (A:) Dixin

SCOPe Domain Sequences for d3pz7a1:

Sequence; same for both SEQRES and ATOM records:

>d3pz7a1 d.15.1.0 (A:386-468) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sstctkvlyftdrsltpfmvnipkrleevtlkdfkaaidregnhryhfkamdpefgtvke
eifhdddaipgwegkivawveed

Timeline for d3pz7a1:

• d3pz7a1 first appeared in SCOPe 2.06
  
• d3pz7a1 appears in SCOPe 2.07