Lineage for d3pqsa4 (3pqs A:385-528)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575840Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2575841Protein automated matches [191257] (5 species)
    not a true protein
  7. 2575842Species Actinobacillus pleuropneumoniae [TaxId:715] [311328] (4 PDB entries)
  8. 2575844Domain d3pqsa4: 3pqs A:385-528 [306263]
    Other proteins in same PDB: d3pqsa1, d3pqsa3
    automated match to d3hola2
    complexed with cac, gol

Details for d3pqsa4

PDB Entry: 3pqs (more details), 2.1 Å

PDB Description: the crystal structures of porcine pathogen aph87_tbpb
PDB Compounds: (A:) transferrin-binding protein

SCOPe Domain Sequences for d3pqsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqsa4 f.4.1.0 (A:385-528) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]}
atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg
givpvfminadikgngftgtanttdtgfaldsgssqhgnavfsdikvnggfygptagelg
gqfhhksdngsvgavfgakrqiek

SCOPe Domain Coordinates for d3pqsa4:

Click to download the PDB-style file with coordinates for d3pqsa4.
(The format of our PDB-style files is described here.)

Timeline for d3pqsa4: