Lineage for d3ppcb2 (3ppc B:404-767)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089888Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2089889Protein automated matches [190717] (5 species)
    not a true protein
  7. 2089916Species Yeast (Candida albicans) [TaxId:5476] [267869] (5 PDB entries)
  8. 2089922Domain d3ppcb2: 3ppc B:404-767 [306254]
    Other proteins in same PDB: d3ppca3, d3ppcb3
    automated match to d4qqua2
    complexed with cl, zn

Details for d3ppcb2

PDB Entry: 3ppc (more details), 2.2 Å

PDB Description: Crystal structure of the Candida albicans methionine synthase by surface entropy reduction, tyrosine variant with zinc
PDB Compounds: (B:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

SCOPe Domain Sequences for d3ppcb2:

Sequence, based on SEQRES records: (download)

>d3ppcb2 c.1.22.0 (B:404-767) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa
kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw
vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv
sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv
atsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnhiglgl
fdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakef
raky

Sequence, based on observed residues (ATOM records): (download)

>d3ppcb2 c.1.22.0 (B:404-767) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtaeeyeafinke
ietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngwvqsygsryvrppiivg
dvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddvsgkiqalqlglalrde
vndlegagitviqvdepaireglplragkersdylnwaaqsfrvatsgvenstqihshfc
ysdldpnhikaldadvvsiefsiqefseypnhiglglfdihspripskqefvsrieeilk
vypaskfwvnpdcglktrgwpevkesltnmveaakefraky

SCOPe Domain Coordinates for d3ppcb2:

Click to download the PDB-style file with coordinates for d3ppcb2.
(The format of our PDB-style files is described here.)

Timeline for d3ppcb2:

  • d3ppcb2 is new in SCOPe 2.06-stable