Lineage for d1kife1 (1kif E:1-194,E:288-339)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67446Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 67447Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 67476Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 67477Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 67478Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 67487Domain d1kife1: 1kif E:1-194,E:288-339 [30625]
    Other proteins in same PDB: d1kifa2, d1kifb2, d1kifc2, d1kifd2, d1kife2, d1kiff2, d1kifg2, d1kifh2

Details for d1kife1

PDB Entry: 1kif (more details), 2.6 Å

PDB Description: d-amino acid oxidase from pig kidney

SCOP Domain Sequences for d1kife1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kife1 c.4.1.2 (E:1-194,E:288-339) D-amino acid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOP Domain Coordinates for d1kife1:

Click to download the PDB-style file with coordinates for d1kife1.
(The format of our PDB-style files is described here.)

Timeline for d1kife1: