SCOPe 2.08: Domain d1kife1: 1kif E:1-194,E:288-339

Lineage for d1kife1 (1kif E:1-194,E:288-339)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
   This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold

6. Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51981] (7 PDB entries)

8. Domain d1kife1: 1kif E:1-194,E:288-339 [30625]
   Other proteins in same PDB: d1kifa2, d1kifb2, d1kifc2, d1kifd2, d1kife2, d1kiff2, d1kifg2, d1kifh2
   complexed with bez, fad

Details for d1kife1

PDB Entry: 1kif, 2.6 Å

PDB Description: d-amino acid oxidase from pig kidney

PDB Compounds: (E:) d-amino acid oxidase

SCOPe Domain Sequences for d1kife1:

Sequence; same for both SEQRES and ATOM records:

>d1kife1 c.4.1.2 (E:1-194,E:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

Timeline for d1kife1:

• d1kife1 first appeared (with stable ids) in SCOP 1.55
  
• d1kife1 appears in SCOPe 2.07