SCOPe 2.08: Domain d3pl4b1: 3pl4 B:116-336

Lineage for d3pl4b1 (3pl4 B:116-336)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.14: FliG [48029] (2 families)
   fragmented superhelix; consist of 3/4-helical motifs and connecting helices

5. Family a.118.14.0: automated matches [191676] (1 protein)
   not a true family

6. Protein automated matches [191304] (1 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [190009] (4 PDB entries)

8. Domain d3pl4b1: 3pl4 B:116-336 [306248]
   Other proteins in same PDB: d3pl4a2, d3pl4b2
   automated match to d3usya_

Details for d3pl4b1

PDB Entry: 3pl4, 2.71 Å

PDB Description: Crystal structure of FliG (residue 116-343) from H. pylori

PDB Compounds: (B:) flagellar motor switch protein

SCOPe Domain Sequences for d3pl4b1:

Sequence; same for both SEQRES and ATOM records:

>d3pl4b1 a.118.14.0 (B:116-336) automated matches {Helicobacter pylori [TaxId: 210]}
qknfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaeisirman
lgeispqvvkrvstvlenklesltsykievgglravaeifnrlgqksakttlariesvdn
klagaikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnnmssraa
eqfveemqylgavkikdvdvaqrkiieivqslqekgviqtg

Timeline for d3pl4b1:

• d3pl4b1 first appeared in SCOPe 2.06
  
• d3pl4b1 appears in SCOPe 2.07