Lineage for d3pkra_ (3pkr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727358Superfamily a.118.14: FliG [48029] (2 families) (S)
    fragmented superhelix; consist of 3/4-helical motifs and connecting helices
  5. 2727369Family a.118.14.0: automated matches [191676] (1 protein)
    not a true family
  6. 2727370Protein automated matches [191304] (1 species)
    not a true protein
  7. 2727371Species Helicobacter pylori [TaxId:210] [190009] (4 PDB entries)
  8. 2727375Domain d3pkra_: 3pkr A: [306245]
    automated match to d3usya_

Details for d3pkra_

PDB Entry: 3pkr (more details), 2.6 Å

PDB Description: Crystal structure of FliG (residue 86-343) from H. pylori
PDB Compounds: (A:) flagellar motor switch protein

SCOPe Domain Sequences for d3pkra_:

Sequence, based on SEQRES records: (download)

>d3pkra_ a.118.14.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
knfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaeisirmanl
geispqvvkrvstvlenklesltsykievgglravaeifnrlgqksakttlariesvdnk
lagaikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnnmssraae
qfveemqylgavkikdvdvaqrkiieivqslqekgviqt

Sequence, based on observed residues (ATOM records): (download)

>d3pkra_ a.118.14.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
knfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaeisirmanl
geispqvvkrvstvlenklesltievgglravaeifnrlgqksakttlariesvdnklag
aikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnnmssraaeqfv
eemqylgavkikdvdvaqrkiieivqslqekgviqt

SCOPe Domain Coordinates for d3pkra_:

Click to download the PDB-style file with coordinates for d3pkra_.
(The format of our PDB-style files is described here.)

Timeline for d3pkra_: