![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
![]() | Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins) |
![]() | Protein automated matches [310873] (1 species) not a true protein |
![]() | Species Treponema pallidum [TaxId:160] [311326] (2 PDB entries) |
![]() | Domain d3pjnb_: 3pjn B: [306244] automated match to d2o6ca_ complexed with edo, so4, zn |
PDB Entry: 3pjn (more details), 1.7 Å
SCOPe Domain Sequences for d3pjnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pjnb_ b.1.33.1 (B:) automated matches {Treponema pallidum [TaxId: 160]} defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps hdeyslhideqtgvsgrfwseplvaewddfewkgpqw
Timeline for d3pjnb_: