SCOPe 2.08: Domain d3pjnb_: 3pjn B:

Lineage for d3pjnb_ (3pjn B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins)

6. Protein automated matches [310873] (1 species)
   not a true protein

7. Species Treponema pallidum [TaxId:160] [311326] (2 PDB entries)

8. Domain d3pjnb_: 3pjn B: [306244]
   automated match to d2o6ca_
   complexed with edo, so4, zn

Details for d3pjnb_

PDB Entry: 3pjn, 1.7 Å

PDB Description: The crystal structure of Tp34 bound to Zn(II) ion at pH 7.5

PDB Compounds: (B:) 34 kDa membrane antigen

SCOPe Domain Sequences for d3pjnb_:

Sequence; same for both SEQRES and ATOM records:

>d3pjnb_ b.1.33.1 (B:) automated matches {Treponema pallidum [TaxId: 160]}
defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv
gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps
hdeyslhideqtgvsgrfwseplvaewddfewkgpqw

Timeline for d3pjnb_:

• d3pjnb_ first appeared in SCOPe 2.06
  
• d3pjnb_ appears in SCOPe 2.07