| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
| Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins) |
| Protein automated matches [310873] (1 species) not a true protein |
| Species Treponema pallidum [TaxId:160] [311326] (2 PDB entries) |
| Domain d3pjlb_: 3pjl B: [306242] automated match to d2o6ca_ complexed with co, edo, so4 |
PDB Entry: 3pjl (more details), 1.7 Å
SCOPe Domain Sequences for d3pjlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pjlb_ b.1.33.1 (B:) automated matches {Treponema pallidum [TaxId: 160]}
defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv
gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps
hdeyslhideqtgvsgrfwseplvaewddfewkgpqw
Timeline for d3pjlb_: