| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
| Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
| Protein Gram-positive bacterial pilin domains [310720] (2 species) |
| Species Streptococcus agalactiae [TaxId:208435] [310966] (1 PDB entry) |
| Domain d3phsa1: 3phs A:31-150 [306238] Other proteins in same PDB: d3phsa3 |
PDB Entry: 3phs (more details), 1.8 Å
SCOPe Domain Sequences for d3phsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phsa1 b.3.5.1 (A:31-150) Gram-positive bacterial pilin domains {Streptococcus agalactiae [TaxId: 208435]}
hqltivhleardidrpnpqleiapkegtpiegvlyqlyqlkstedgdllahwnsltitel
kkqaqqvfeattnqqgkatfnqlpdgiyyglavkageknrnvsaflvdlsedkviypkii
Timeline for d3phsa1: