Lineage for d3pezc1 (3pez C:2-381)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066522Superfamily b.69.14: Nucleoporin domain [117289] (1 family) (S)
  5. 2066523Family b.69.14.1: Nucleoporin domain [117290] (2 protein domains)
  6. 2066527Protein Nucleoporin NUP159 [117293] (1 species)
  7. 2066528Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117294] (3 PDB entries)
    Uniprot P40477 2-381
  8. 2066531Domain d3pezc1: 3pez C:2-381 [306236]
    Other proteins in same PDB: d3peza1, d3peza2, d3pezc2
    automated match to d1xipa_
    complexed with adp, ihp, mg

Details for d3pezc1

PDB Entry: 3pez (more details), 2.9 Å

PDB Description: S. cerevisiae Dbp5 L327V bound to Nup159, Gle1 H337R, IP6 and ADP
PDB Compounds: (C:) Nucleoporin NUP159

SCOPe Domain Sequences for d3pezc1:

Sequence, based on SEQRES records: (download)

>d3pezc1 b.69.14.1 (C:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdtier
lplvyilnnegslqivglfh

Sequence, based on observed residues (ATOM records): (download)

>d3pezc1 b.69.14.1 (C:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtrlplvyilnnegs
lqivglfh

SCOPe Domain Coordinates for d3pezc1:

Click to download the PDB-style file with coordinates for d3pezc1.
(The format of our PDB-style files is described here.)

Timeline for d3pezc1:

  • d3pezc1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3pezc2