SCOPe 2.08: Domain d3peza1: 3pez A:98-286

Lineage for d3peza1 (3pez A:98-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)

8. Domain d3peza1: 3pez A:98-286 [306234]
   Other proteins in same PDB: d3pezc1, d3pezc2
   automated match to d3peya1
   complexed with adp, ihp, mg

Details for d3peza1

PDB Entry: 3pez, 2.9 Å

PDB Description: S. cerevisiae Dbp5 L327V bound to Nup159, Gle1 H337R, IP6 and ADP

PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3peza1:

Sequence; same for both SEQRES and ATOM records:

>d3peza1 c.37.1.0 (A:98-286) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
glapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsltmltrvn
pedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaqvivgtpg
tvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlfsatfada
vrqyakkiv

Timeline for d3peza1:

• d3peza1 first appeared in SCOPe 2.06
  
• d3peza1 appears in SCOPe 2.07