Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (3 families) active form is a dimer |
Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins) Pfam PF08915 |
Protein automated matches [310853] (2 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [311214] (5 PDB entries) |
Domain d3pd5b_: 3pd5 B: [306233] automated match to d1y2qa_ protein/RNA complex; complexed with gol, tsb |
PDB Entry: 3pd5 (more details), 2.29 Å
SCOPe Domain Sequences for d3pd5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pd5b_ c.110.1.2 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]} mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy kafkisckghplaelsrtivpeearve
Timeline for d3pd5b_: