SCOPe 2.08: Domain d3pd5b_: 3pd5 B:

Lineage for d3pd5b_ (3pd5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (3 families)
   active form is a dimer

5. Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
   Pfam PF08915

6. Protein automated matches [310853] (2 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [311214] (5 PDB entries)

8. Domain d3pd5b_: 3pd5 B: [306233]
   automated match to d1y2qa_
   protein/RNA complex; complexed with gol, tsb

Details for d3pd5b_

PDB Entry: 3pd5, 2.29 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with an analog of threonyl-adenylate

PDB Compounds: (B:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d3pd5b_:

Sequence; same for both SEQRES and ATOM records:

>d3pd5b_ c.110.1.2 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
kafkisckghplaelsrtivpeearve

Timeline for d3pd5b_:

• d3pd5b_ first appeared in SCOPe 2.06
  
• d3pd5b_ appears in SCOPe 2.07